We 'ingest and inhale microplastics' constantly - but there's hope microplasticsclimateclimate changeplastic wasteplasticenvironmentuniversity of portsmouthnewsmicroplasticsJan 16, 2025
Plastic chemicals contributing to thousands of global deaths newshealthenvironmentplasticplastic wastenewsDec 17, 2024
Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
Pro-Trump influencers are trying to distance themselves from president donald trumpinfluencerspodcastersjoe roganadin rosstheo vonandrew schulzdonald trump15h
GTA 6 LIVE: Game gets double 2025 Golden Joystick Awards nomination gta 6gamesgrand theft autorockstar gamesvideo gamesgta 6Oct 05, 2025
What is 67? How a collaboration with Natasha Bedingfield took over tiktok trend67natasha bedingfieldgen alphatiktok trend10h
What is ‘bio-baiting’? The sneaky new dating trend fooling singles datingdating trendbio baitingdating appsrelationshipsdatingSep 26, 2025
The biggest predictions for Taylor Swift's new album 'The Life of A Showgirl' taylor swiftthe life of a showgirlmusicalbumpredictionsswiftiestaylor swiftOct 02, 2025
Did the US government shut down? Everything we know government shutdownusacitizensrepublicansdemocratshealthcaretrump administrationdonald trumpgovernment shutdownOct 01, 2025
Emma Watson opens up about JK Rowling rift over transgender rights emma watsonjk rowlingharry pottertransgendergender identityjay shettypodcastemma watsonSep 26, 2025
