We 'ingest and inhale microplastics' constantly - but there's hope microplasticsclimateclimate changeplastic wasteplasticenvironmentuniversity of portsmouthnewsmicroplasticsJan 16, 2025
Plastic chemicals contributing to thousands of global deaths newshealthenvironmentplasticplastic wastenewsDec 17, 2024
Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
12 times Trump has seemingly 'fallen asleep' in his second term Donald Trumpsleepingtrumpwhite houseoval officenewsdonald trumpDonald TrumpFeb 21, 2026
Trump’s ‘insane’ tariff tantrum stuns social media Donald Trumpnewstrumpsupreme courttariffswhite housedonald trumpDonald TrumpFeb 21, 2026
All the biggest viral moments from the Winter Olympics winter olympicsmilansturla holm laegreidcondomsice hockeyskiingcurlingmedalsminionsice skatingdogwinter olympicsFeb 21, 2026
Trump ridiculed as his latest move on Greenland has one big problem Donald Trumpgreenlandus navydenmarknewshealthcaredonald trumpDonald Trump7h
White House tariff tweet has X/Twitter users thinking the same thing Donald Trumpnewstrumppenguinbatmantariffssupreme courtdonald trumpDonald TrumpFeb 21, 2026
Joe Rogan is complaining about 'overwhelming' Trump news - yes, really joe roganjoe rogan experiencenewstrumpdonald trumppodcastjoe rogan9m
OpenAI boss' comments on energy consumption branded 'dystopian' sam altmanchatgptopenaiopen aiartificial intelligencenewssam altman24m
Harry Styles is curating a London festival - what you need to know harry stylesmusicfestivalsouthbanklondoncultureartharry stylesFeb 16, 2026
