We 'ingest and inhale microplastics' constantly - but there's hope microplasticsclimateclimate changeplastic wasteplasticenvironmentuniversity of portsmouthnewsmicroplasticsJan 16, 2025
Plastic chemicals contributing to thousands of global deaths newshealthenvironmentplasticplastic wastenewsDec 17, 2024
Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
GTA 6 LIVE: Sex scenes confirmed as new rating details revealed gta 6gamesgrand theft autorockstar gamesvideo gamesgta 62h
People are turning to ‘dopamine websites’ to go shopping social mediashoppingviraltiktoksocial mediaSep 30, 2026
Karoline Leavitt tried to own the Dems – it backfired over basic math karoline leavittfox newsdemocratsmidtermskaroline leavittSep 29, 2026
Davidson defends ex Grande and 'doesn't understand' scrutiny she faced pete davidsonariana granderelationshipexesbody imagekim kardashianhealthpete davidsonOct 01, 2026
JD Vance 'accidentally' sinks to fart joke level at campaign rally jd vancenorth carolinacampaignrallyrepublicanmidterm electionsgopjd vanceSep 22, 2026
Gavin Newsom signs executive order directly opposing Trump gavin newsomaidonald trumpartificial intelligencegavin newsom3h
9 times Trump claimed victory in the ongoing Iran war Donald Trumptrumpiraniran warnewstrump administrationdonald trumpDonald TrumpOct 01, 2026
