We 'ingest and inhale microplastics' constantly - but there's hope microplasticsclimateclimate changeplastic wasteplasticenvironmentuniversity of portsmouthnewsmicroplasticsJan 16, 2025
Plastic chemicals contributing to thousands of global deaths newshealthenvironmentplasticplastic wastenewsDec 17, 2024
Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
Did Donald Trump get Folarin Balogun's red card ban overturned? donald trumpfifausmntworld cupworld cup 2026donald trump22h
GTA 6 LIVE: Trailer 3 and next marketing details 'revealed' gta 6gamesgrand theft autorockstar gamesvideo gamesgta 617m
Who will England play in their World Cup quarter-finals match? englandworld cupfootballsoccernorwayerling haalandmexicobrazilengland21h
World Cup fans are obsessed with Erling Haaland's Snapchat erling haalandsnapchatworld cupfootballnorwayerling haalandJun 26, 2026
Watch Belgium players troll Donald Trump with brilliant goal celebration world cupdonald trumpbelgiumfootballworld cup 2026world cup14m
I’ve done countless longevity tests - 3 everyone should consider wellnesshealthlifestylebiohackingwellnessJun 30, 2026
People think Mike Johnson gave Democrats an election slogan by mistake mike johnsonusmike johnsonJun 27, 2026