We 'ingest and inhale microplastics' constantly - but there's hope microplasticsclimateclimate changeplastic wasteplasticenvironmentuniversity of portsmouthnewsmicroplasticsJan 16, 2025
Plastic chemicals contributing to thousands of global deaths newshealthenvironmentplasticplastic wastenewsDec 17, 2024
Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
Stranger Things conspiracy falls flat amid 'Netflix crash' stranger thingsnetflixtvconspiracyconspiracy theorysocial mediaxstranger things5h
GTA 6 LIVE: Release date update and development state revealed gta 6grand theft autorockstar gamesvideo gamesgamesgta 65h
If you’re a victim of Grok’s AI ‘undressing’ tool - here’s what to do grokelon musksocial mediaaiartificial intelligencegrok4h
US O-1B visa draws Ali G comparisons amid influencer and OnlyFans surge donald trumpusvisaali gdonald trump22m
Trump accused of ‘vandalism’ over 'downright weird' name change Donald Trumpkennedy centerkaroline leavittnewsjohn f kennedydepartment of wardonald trumpDonald TrumpDec 20, 2025
Are Instagram likes dead? Real reason behind 'like recession' lifestyleinstagramengagementsocial medialikesexpertlifestyleJan 06, 2026
Did this Prime Video show 'predict' US-Venezuela intervention? tvjack ryanjohn krasinskiusvenezuelapredictiontvJan 05, 2026
The biggest reactions to the Stranger Things finale episode tvstranger thingsnetflixtv showtv seriesduffer brothersmillie bobby brownnoah schnapptvJan 01, 2026
