We 'ingest and inhale microplastics' constantly - but there's hope microplasticsclimateclimate changeplastic wasteplasticenvironmentuniversity of portsmouthnewsmicroplasticsJan 16, 2025
Plastic chemicals contributing to thousands of global deaths newshealthenvironmentplasticplastic wastenewsDec 17, 2024
Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
Trump’s comments about attending own son’s wedding spark disbelief donald trumpdonald trump jrusirandonald trump6h
GTA 6 LIVE: Trailer 3 release date 'revealed' gta 6gamesgrand theft autorockstar gamestake-twovideo gamesgta 66h
Stephen Colbert gives emotional goodbye in closing monologue stephen colbertcancelledcbsjon batistelast showpaul mccartneythe late show with stephen colbertstephen colbert7h
I've tried Kylie Jenner's sold out electrolytes - what I really think beautyskinskincarekylie jennerwellnessbeauty2h
PS6 release date and price updates have gamers agreeing about one thing ps6consolesgamesplaystationsonyvideo gamesps62h
New Nintendo Direct details 'leaked' by insider nintendogamesnintendo switchnintendo switch 2switchswitch 2video gamesnintendo2h
Tomb Raider: Legacy of Atlantis official update - it's the best news tomb raidercrystal dynamicsembracer groupgameslara croftvideo gamestomb raider2h
