Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
GTA 6 LIVE: Rockstar Games 'teases' trailer 2 release date gta 6gamesgrand theft autorockstar gamesvideo gamesgta 6Nov 29, 20241732874701
Stallone apologises to Paul over 'Oscar-winning performance' claim sylvester stallonejake paulmike tysonboxingfightapologyinstagramsylvester stalloneNov 29, 20241732874511
Peanut the squirrel's owners are suing New York for 'executing' pet peanut the squirrellawsuitnew yorkpeanut the squirrelNov 28, 2024
Father of YouTuber who died in snowstorm vows to recover last video youtuberswedenweathernewsyoutuberNov 29, 2024
TikTok's 10 biggest trending words of 2024 ranked by language expert tiktokviraltiktokcharli xcxbrat summermanifestraw-dogginggirl dinnerlifestyleNov 29, 2024
'Church choir' speak out after viral Like A Prayer Christmas cover MadonnamusicviraltiktokchristmasreligionchristianitymadonnaMadonnaNov 28, 2024
What is swatting and why is it so dangerous? swattingviralus newscelebritiesdonald trumppoliticsnewsswattingNov 28, 2024
