We 'ingest and inhale microplastics' constantly - but there's hope microplasticsclimateclimate changeplastic wasteplasticenvironmentuniversity of portsmouthnewsmicroplasticsJan 16, 2025
Plastic chemicals contributing to thousands of global deaths newshealthenvironmentplasticplastic wastenewsDec 17, 2024
Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
Here's where you've seen the Ariana Grande premiere invader before wicked: for goodwickedcynthia erivoariana grandesingaporepremierenewswicked: for goodNov 14, 2025
GTA 6 LIVE: 'We got Red Dead Redemption on mobile before GTA 6' gta 6gamesgrand theft autorockstar gamesvideo gamesgta 6Nov 14, 2025
Millennials are losing it over Vine’s comeback — and it has new rules vinemillennialsdivineaiartificial intelligencesocial mediatwitterjack dorseyevan henshaw plathvineNov 14, 2025
1 million Toyota Lexus and Subaru Solterras recalled - what to know toyotarecallcarstoyotaNov 06, 2025
Zohran Mamdani's marriage is helping people keep faith in dating apps zohran mamdaninew yorkmarriagedating appsrelationshipsrama duwajizohran mamdaniNov 06, 2025
Kim Kardashian's 'All's Fair' declared 'worst TV show ever' all's fairkim kardashiantv seriesdivorceryan murphyall's fairNov 05, 2025
Donald Trump gets a new nickname after Epstein emails released donald trumpjeffrey epsteinepstein filesdonald trumpNov 13, 2025
The tragic story behind the 'world's most dangerous substance' chernobylelephant's footukrainemost dangerous substance in the worldnuclearradioactivechernobylNov 14, 2025
