We 'ingest and inhale microplastics' constantly - but there's hope microplasticsclimateclimate changeplastic wasteplasticenvironmentuniversity of portsmouthnewsmicroplasticsJan 16, 2025
Plastic chemicals contributing to thousands of global deaths newshealthenvironmentplasticplastic wastenewsDec 17, 2024
Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
MrBeast wants 'volunteers' to test viral 100 men vs 1 gorilla debate trendgorillahumandebatefighttrend10h1745935308
GTA 6 LIVE: Release date reveal expected imminently says insider gta 6rockstar gamesgrand theft autovideo gamesgamestake-twogta 6Apr 27, 20251745738755
Scientists discover creature 'beyond imagination' encased in amber naturewaspsscientistspaleontologypaleontologistsmyanmarnatureApr 26, 2025
Ryan Reynolds' and Blake Lively's emotional posts after Wrexham promotion ryan reynoldsblake livelywrexhamrob mcelhenneyfootballryan reynoldsApr 27, 2025
Trump claims US and China are negotiating over tariffs - China deny it donald trumptariffschinabeijingchina tariffsdonald trumpApr 24, 2025
Scientists find more evidence of life on distant planet K2-18b astronomersfind life on another planetplanetsscientistsk2-18bastronomersApr 17, 2025
Trump and Musk poll shows their popularity - they should be worried donald trumpelon musktrumppollpopularitydogedonald trumpApr 16, 2025
‘Worst president ever’: Donald Trump’s first 100 days slammed online donald trumppresidentwhite housedonald trump11h
