We 'ingest and inhale microplastics' constantly - but there's hope microplasticsclimateclimate changeplastic wasteplasticenvironmentuniversity of portsmouthnewsmicroplasticsJan 16, 2025
Plastic chemicals contributing to thousands of global deaths newshealthenvironmentplasticplastic wastenewsDec 17, 2024
Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
Donald Trump posts unhinged response to White House ballroom decision white houseus politicsdonald trumptruth socialtrumpwhite house20h
GTA 6 LIVE: Netflix extended look details teased by Take-Two CEO gta 6grand theft autorockstar gamesvideo gamesgamesgta 621h
15 best Donald Trump hair memes as US President's full locks go viral viraldonald trumpsocial mediatrumpus politicsviral18h
Watch viral moment Donald Trump gets cooked by reporter in four words us politicspoliticsdonald trumptrumpreporterviral videous politics19h
Trump continues attack on Kaitlan Collins with 'unhinged' AI post donald trumpkaitlan collinsdonald trumpJul 27, 2026
Trump spoke about when he’s leaving office – and people aren’t happy donald trumpuswhite housedonald trump18h
Tate McRae responds to accusations of supporting MAGA tate mcraemagamusicmorgan wallencanadafanstate mcrae18h
Trump says electric car owners 'have a disease' but there's a problem donald trumpelectric carselectric vehiclestesladonald trump18h
