We 'ingest and inhale microplastics' constantly - but there's hope microplasticsclimateclimate changeplastic wasteplasticenvironmentuniversity of portsmouthnewsmicroplasticsJan 16, 2025
Plastic chemicals contributing to thousands of global deaths newshealthenvironmentplasticplastic wastenewsDec 17, 2024
Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
Obama just clarified his stance on aliens after that viral clip barack obamaobamanewsaliensinterviewconspiracy theorybarack obama2h
GTA 6 LIVE: Release date update splits opinion on social media gta 6gamesgrand theft autorockstar gamesvideo gamesgta 6Feb 12, 2026
People are just realising the NFT 'stupidity' after Logan Paul fail nftcelebsjustin bieberlogan paulnft3h
The 34 most stupid things Donald Trump has ever said donald trumptrumpus politicsrepublicankamala harrisdonald trumpJan 20, 2026
5,000-year-old discovery rewrites history of ancient technology ancient egypttechnologyhistoryarchaeologyresearchartefactsancient egypt35m
Ancient Romans used poo for medicine - here's how we know ancient romepoohistoryturkeyromansmedicinehealthancient romeFeb 12, 2026
Presidential approval rating polls to stop after 88 years pollsgalluppoliticsapproval ratingspollsFeb 12, 2026
Musk has just waded into the debate on Keir Starmer’s future Elon Musknewsjk rowlingkeir starmertrans rightsepstein fileselon muskElon MuskFeb 09, 2026
Harry Styles announces £20 ‘One Night Only’ Manchester show - how to request tickets harry stylesFeb 05, 2026
