We 'ingest and inhale microplastics' constantly - but there's hope microplasticsclimateclimate changeplastic wasteplasticenvironmentuniversity of portsmouthnewsmicroplasticsJan 16, 2025
Plastic chemicals contributing to thousands of global deaths newshealthenvironmentplasticplastic wastenewsDec 17, 2024
Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
Roblox drama explained as CEO under huge pressure after Schlep ban robloxcontent creatoryoutuberexplainerdramaroblox16h
GTA 6 LIVE: New release date update is what every gamer wants to hear gta 6rockstar gamesvideo gamesgamesgrand theft autogta 617h
'Spectacular' hidden structures discovered deep beneath Antarctica antarcticacanyondiscoveryunderwaterresearchantarcticaAug 15, 2025
E.L.F. Cosmetics' 'disappointing' Matt Rife cameo – backlash explained matt rifebeautyelfmatt rifeAug 15, 2025
The internet is planning outfits for the ‘Life Of A Showgirl’ tour Taylor Swiftmusictravis kelceeras tourTaylor SwiftAug 14, 2025
9 biggest takeaways from Taylor Swift on New Heights podcast taylor swifttravis kelcejason kelcenew heightspodcastthe life of a showgirleras toureaster eggsmusicamerican footballtaylor swiftAug 14, 2025
Taylor Swift announces new album - track list, reaction and release date revealed taylor swiftswiftiesnew albummusicpop cultureeaster eggstravis kelcejason kelcenew heightsmax martinsabrina carpenterthe life of a showgirlerastaylor swiftAug 14, 2025
First-ever White House UFC fight is in the works - everything we know ufctrumpwhite housedana whiteivanka trumpjuly 4independence dayufcAug 13, 2025
