We 'ingest and inhale microplastics' constantly - but there's hope microplasticsclimateclimate changeplastic wasteplasticenvironmentuniversity of portsmouthnewsmicroplasticsJan 16, 2025
Plastic chemicals contributing to thousands of global deaths newshealthenvironmentplasticplastic wastenewsDec 17, 2024
Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
Trump protests: Everything we know about the ‘No Kings’ protests today trumpdonald trumpprotestsmilitaryparadewashington dcphiladelphiatrump10h
What time is Trump's D.C. military parade taking place today? trumpmilitaryparadewashington dcdonald trumpus armytrump1h
Trump's retort to 'No Kings' protesters as US cities prep for marches trumpdonald trumpprotestersresponsekingmilitaryparadetrump3h
One year of Hawk Tuah Girl: Haliey Welch's rise to fame and biggest controversy hawk tuahhaliey welchsocial mediaviral videocryptocurrencyhawk tuah6h
'You're an embarrassment to this country': Hegseth slammed over Trump pete hegsethcarbajalcongressmanembarrassmenthegsethrepresentativeslamsto countryunfit to leadpete hegsethJun 13, 2025
Bizarre moment Donald Trump appears to claim Putin fought in WWII donald trumpbizarreclaimsfoughtmomentpress conferenceputintrumpwhite housewwiidonald trumpJun 13, 2025
Miracle moment: British Air India crash 'survivor' emerges air india crashboeingbritish mancrashflightgatwick airportsurvivorair india crashJun 12, 2025
"I know I'm a woman": Congresswoman calls out man for interrupting her secretary scott bessentJun 12, 2025
Woman kicked out of court for making a sandwich in her bathrobe sandwich in court hearingJun 12, 2025
