We 'ingest and inhale microplastics' constantly - but there's hope microplasticsclimateclimate changeplastic wasteplasticenvironmentuniversity of portsmouthnewsmicroplasticsJan 16, 2025
Plastic chemicals contributing to thousands of global deaths newshealthenvironmentplasticplastic wastenewsDec 17, 2024
Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
‘Art of the deal’: Trump mocked by critics over Iran ceasefire deal donald trumpiraniran warusdonald trump10h
GTA 6 LIVE: Trailer 3 or pre-orders announcement 'cooking' gta 6gamesgrand theft autorockstar gamesvideo gamesgta 6Apr 05, 2026
Awkward moment Artemis II astronauts go silent after Donald Trump rant artemis iidonald trumpmoonspacenasaartemis iiApr 07, 2026
The Boys Season 5 - Everything we know about the final series the boystvtv showprime videothe boyssuperheroeshomelander2h
Harry Styles is curating a London festival - what you need to know harry stylesmusicfestivalsouthbanklondoncultureartharry stylesApr 07, 2026
'I'm looking for a heavy-set gentleman': Trump mocks JD Vance's weight donald trumpjd vancedonald trumpApr 02, 2026
Why Kris Jenner’s profile picture trend is going viral across Chinese social media kris jennercareerchinagen zlifestylemanifestmanifestationmoneytiktok trendkardashiansthe kardashianskris jennerApr 01, 2026
Connor Storrie and Hudson Williams land new roles after Heated Rivalry heated rivalryconnor storriehudson williamsfilmtvheated rivalryMar 30, 2026
Stephen King posts savage cartoon of Trump’s Iran war ‘situation room’ stephen kingApr 07, 2026
