We 'ingest and inhale microplastics' constantly - but there's hope microplasticsclimateclimate changeplastic wasteplasticenvironmentuniversity of portsmouthnewsmicroplasticsJan 16, 2025
Plastic chemicals contributing to thousands of global deaths newshealthenvironmentplasticplastic wastenewsDec 17, 2024
Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
Trump shares another White House restoration - people aren't impressed donald trumpwhite houseusdonald trump4h
GTA 6 LIVE: 'Leaks' appear online - but they might be out of date gta 6gamesgrand theft autorockstar gamesvideo gamesgta 66h
Alix Earle brings Kardashian-style reality show to Netflix netflixtvtv showalix earletiktoksocial medianetflix5h
Blue Zones: 5 foods eaten in Sardinia for longevity wellnesslongevitybiohackinghealthtravelsardiniawellness1h
What is going on with KATSEYE? Sophia Laforteza hiatus explained katseyemanon bannermansophia lafortezahybe x geffenhybemusicgirl groupkatseye2h
Trump jokes he's 'concerned' Leavitt likes her children more than him donald trumpkaroline leavittdonald trumpAug 17, 2026
Trump already wants the credit for the next president's achievements donald trumpus presidentus presidencydonald trumpAug 11, 2026
Trump appears to doze off again during Oval Office press event donald trumpoval officesleepingdonald trumpAug 11, 2026
