We 'ingest and inhale microplastics' constantly - but there's hope microplasticsclimateclimate changeplastic wasteplasticenvironmentuniversity of portsmouthnewsmicroplasticsJan 16, 2025
Plastic chemicals contributing to thousands of global deaths newshealthenvironmentplasticplastic wastenewsDec 17, 2024
Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
Reaction as Trump defends proposed $400m 'gift' from Qatari royals donald trumpqatarair force onejetboeingdonald trump19h1747040052
GTA 6 LIVE: Trailer 2 and screenshots 'reveal' playable minigames gta 6grand theft autorockstar gamesvideo gamesgamesgta 620h1747035229
Amouranth's husband complains about income dropping from $2m to $1.2m amouranthincomestreamerkickonlyfansamouranth20h
Kourtney Kardashian teams up with Julia Fox for Lemme kourtney kardashianjulia foxlemmelemme playtiktokkanye westkim kardashianthe kardashianslifestylecelebskourtney kardashian18h
‘Worst president ever’: Donald Trump’s first 100 days slammed online donald trumppresidentwhite housedonald trumpApr 29, 2025
Blake Lively's rep responds to Justin Baldoni's Taylor Swift subpoena blake livelytaylor swiftjustin baldoniit ends with usblake lively16h
Elon Musk says 'quiet trial' of Trump's 'gold card visa' is happening donald trumpelon muskvisausgreen cardgold carddonald trump17h
Reporter jokes cardinals are 'rawdogging' the conclave without tech conclavepopepope francisvatican cityraw-doggingconclaveMay 08, 2025
