Rebel Wilson’s comments on weight loss sparks fatphobia debate rebel wilsonweightpeopleweight lossfatphobiahealthactoraustraliandebaterebel wilsonJan 30, 2021
Russian doctor plays piano as police raid her home alexei navalnyvladmir putinalexei navalnyJan 29, 2021
Jacob Rees-Mogg accused of sexism over comments about Sturgeon nicola sturgeonjacob rees-moggboris johnsonnicola sturgeonJan 29, 2021
Fans have noticed some similarities between The Crown and Bridgerton the crownbridgertonnetflixthe crownJan 29, 2021
Controversial ‘banned’ documentary about royals briefly resurfaces royalsbbcroyal familyyoutubethe queenroyalsJan 29, 2021
Seth Rogen’s mother wrote a hilarious statement about his new book seth rogenseth rogenJan 28, 2021
Black actors are revealing how bad Hollywood is at handling their hair actorshairhollywooddiversityactorsJan 28, 2021
People think Biden’s press secretary looks like Scandal character jen psakijoe bidenjen psakiJan 26, 2021
‘Disturbing’ ghost in new Ghostbusters movie is terrifying everyone ghostbusters: afterlifesonyghostbustersghostbusters: afterlifeJan 25, 2021
A complete timeline of Ted Cruz and Seth Rogen’s Twitter beef seth rogented cruzseth rogenJan 25, 2021
Trump Jr tried to brag about his father’s presidency and it backfired donald trump jrtrumpfathersonlegacypresidenthistorydonald trump jrJan 25, 2021
Davina McCall had the perfect response to being body-shamed davina mccallbody shamingdavina mccallJan 25, 2021
Trump supporter cites Lord of the Rings in bizarre election lawsuit trumplord of the ringsvoter fraudtrumpJan 25, 2021
Pop stars are so bored in quarantine they’ve started summoning aliens keshademi lovatoalienskeshaJan 24, 2021
Fox News calls Biden’s presidency ‘disastrous’ after less than a day joe bidensean hannityfox newsjoe bidenJan 22, 2021
Plot twist, Dakota Johnson doesn’t actually love limes dakota johnsonjimmy fallondakota johnsonJan 22, 2021
Gordon Ramsay has started some beef with a vegan TikTok user gordon ramsaytiktokvegangordon ramsayJan 22, 2021
Kylie Jenner actually does have ‘amazing’ water pressure kylie jennerinstagramkylie jennerJan 22, 2021
13 facts about Netflix’s Bridgerton that you might have missed bridgertonshonda rhimesnetflixbridgertonJan 18, 2021
Mother gets called out by kid for saying ‘Antifa attacked the Capitol’ trumpcapitoltrumpJan 18, 2021
Kylie Jenner gets hilariously roasted for shower’s water pressure kylie jennershowerinstagramkylie jennerJan 18, 2021
Brexiteer who voted for control of UK waters baffled by trade deal lbcbrexitjames o'brienfishinglbcJan 16, 2021
Tucker Carlson called ‘vile’ for jokes about AOC’s riot fears alexandria ocasio-cortezfox newscapitoltucker carlsonalexandria ocasio-cortezJan 15, 2021
Captain America creator’s son has a brutal message for MAGA rioters jack kirbydonald trumpcapitolcaptain americajack kirbyJan 15, 2021
Women using Bumble to report MAGA rioters to the police bumblewashington dcmagacapitolbumbleJan 15, 2021
Paloma Faith faces backlash for saying wearing PPE made her ‘look OCD’ paloma faithocdpaloma faithJan 11, 2021
Video shows ‘hero’ Black officer steering Capitol mob away from Senate capitol riottrumpcapitol riotJan 11, 2021
Teens are comparing Capitol riots to school shootings capitol riottiktokgun controlcapitol riotJan 11, 2021
Lana Del Rey faces backlash over ‘tone-deaf’ post about new album lana del reylana del reyJan 11, 2021
Arnold Schwarzenegger compares Capitol mob to Nazis in scathing video arnold schwarzeneggerdonald trumpcapitolarnold schwarzeneggerJan 11, 2021
The UK asked for questions about coronavirus and it did not go well coronavirustwitterprime ministerukcoronavirusJan 11, 2021
Karlie Kloss called out sister-in-law Ivanka Trump with just two words karlie klossivanka trumpjared kushnerkarlie klossJan 08, 2021
Chris Evans accused of hypocrisy for comments on Capitol riots chris evansdonald trumpchris evansJan 08, 2021
Republican senator ridiculed for calling dropped book deal ‘Orwellian’ josh hawley1984josh hawleyJan 08, 2021
Brexiteer lobby group moves to Ireland to keep domain irelandeubrexitnigel faragearron banksukirelandJan 08, 2021
David Bowie calls out MTV for racism in resurfaced 1983 interview david bowiemtvdavid bowieJan 08, 2021
Why people are divided on ‘Clap for Carers’ coming back last night clap for carersnhsclap for carersJan 08, 2021
Gwen Stefani’s fiancée’s song about her but it hasn’t gone down well blake sheltongwen stefaniblake sheltonJan 04, 2021
Did Trump forget to say his own name? Donald Trumpnewsnflmarylandmilitarywashington commandersdetroit lionsdonald trumpDonald Trump14h
GTA 6 LIVE: Status of game 'revealed' by insider after delay gta 6gamesgrand theft autorockstar gamesvideo gamesgta 614h
New 'language' discovered to be developing in the United States languagelinguisticlanguageunited statesmiamispanishusenglishNov 09, 2025
1 million Toyota Lexus and Subaru Solterras recalled - what to know toyotarecallcarstoyotaNov 06, 2025
Zohran Mamdani's marriage is helping people keep faith in dating apps zohran mamdaninew yorkmarriagedating appsrelationshipsrama duwajizohran mamdaniNov 06, 2025
Kim Kardashian's 'All's Fair' declared 'worst TV show ever' all's fairkim kardashiantv seriesdivorceryan murphyall's fairNov 05, 2025
Elon Musk condemned over ‘civil war in Britain’ remarks Elon Musknewscivil warimmigrationtwitterbritainelon muskElon MuskOct 30, 2025
Call of Duty: Black Ops 7 release date confusion continues call of dutyactivisionblack opsgamesvideo gamescall of duty10h