Trump makes outlandish bin Laden claim but the dates don't add up donald trump911claiminaccurateosama bin ladenpete hegsethwarningyear beforedonald trumpOct 06, 2025
Karoline Leavitt warns those voting against the 'Big Beautiful Bill' big beautiful billbilldonald trumpkaroline leavittno tax on tipstax breaksvoting againstwarningwarnsbig beautiful billJun 03, 2025
Ms Rachel shares sweet video with Gaza refugee after UN announcement ms rachelchildrenfatalgazaisraelpalestinepalestinianrefugeesunwarningms rachelMay 22, 2025
Massive solar flares erupt from the Sun sparking NASA warning spacesolar flareradiosunblackoutwarningnasaspaceMay 20, 2025
Hotel worker reveals why you should never use the free toiletries travelviralhotelwarningtiktoktiktok trendtravelMay 16, 2025
Hotel worker reveals why you should never use the free toiletries travelviralhotelwarningtiktoktiktok trendtravelMay 11, 2025
Woman's warning after massage gun used on wrong area lands her in A&E massage gunmassagehospitalwarningmassage gunMar 25, 2025
Health warning sent over viral 'car mukbang' TikToks tiktok trendfoodmukbangtiktokcarexpertwarningtiktok trendJan 10, 2025
People are injuring themselves trying out the Superman trend on social media tiktoktrendsupermanwarninginjuryschooltiktokDec 10, 2024
Expert warns against lip gloss phone case trend trendphone caselip glossbeautytechnologywarningtrendNov 27, 2024
Study shows what 'mouth taping' really does to people with sleep apnea sleepwellnesswarningsleep apneamouth tapingviral trendtrendtiktok trendsleepNov 14, 2024
Doctor cautions against the viral protein Diet Coke trend healthtiktokdiet coketrendwarninghealthNov 06, 2024
GPs warn against rise in scabies as experts urge not to ignore rashes healthrashgpdoctorwarningwellnessscabieshealthOct 25, 2024
Airport staff warn people about tying ribbons to luggage travelluggageplaneflyingtravel hacksuitcasewarningairportplanestravelAug 24, 2024
Hotel worker reveals why you should never use the free toiletries travelviralhotelwarningtiktoktiktok trendtravelJun 30, 2024
Airport staff warn people about old age trick of tying ribbons to luggage travelluggageplaneflyingtravel hacksuitcasewarningairportplanestravelJun 07, 2024
Doctor warns against using hotel amenity due to bug infestation risk travelhoteldoctortiktokwarningbed bugstravelJun 06, 2024
City warns of toxic cat roaming the streets after chemical vat accident catschemicalswarningtoxicjapancatsMar 13, 2024
Hotel worker reveals why you should never use the free toiletries travelviralhotelwarningtiktoktiktok trendtravelDec 23, 2023
TikToker warns people not to explore Paris Catacombs for these reasons parisfrancecatacombswarningparisNov 13, 2023
Storm Babet: 14 wild photos and videos as extreme weather hits the UK storm babetmet officeweatherwarningukstorm babetOct 20, 2023
TikToker has warning for women after an AirPod was used to track her airpodswarningviralairpodsOct 13, 2023
Hotel worker reveals why you should never use the free toiletries travelviralhotelwarningtiktoktiktok trendtravelSep 24, 2023
Hotel worker reveals why you should never use the free toiletries travelviralhotelwarningtiktoktiktok trendtravelAug 02, 2023
Everything you need to know about the UK's emergency alert test emergencyemergency servicessmartphonessmartphonealarmwarningtexttext messagetext messagestextsemergencyApr 23, 2023
This is when the UK's emergency alert test message will be sent emergencyemergency servicessmartphonessmartphonealarmwarningtexttext messagetext messagestextsemergencyApr 21, 2023
This is when the UK's emergency alert test message will be sent emergencyemergency servicessmartphonessmartphonealarmwarningtexttext messagetext messagestextsemergencyApr 06, 2023
Don't sacrifice your friend to survive a bear attack, US govt pleads governmentbear attackbearviralwarningusgovernmentMar 02, 2023
The Pope warns about a demonic threat in his midst pope franciscardinalschristmasdemonvaticanwarningpope francisDec 22, 2022
'Time traveler from 2671' says four dates in December will be huge time travelwarningearthdecembertime travelNov 19, 2022
Fire brigade says please stop cooking steak in your toaster viralcookingfirefire brigadesteaktiktokwarningviralNov 18, 2022
Please do not try the sleepy chicken TikTok trend, doctors say tiktoktrendwarningtiktokchickenwellnessJan 21, 2022
A new UN report issued climate change warning – here’s what it says unclimate changeintergovernmental panel on climate changewarningtemperaturesearthparis climate change agreementgreenhouse emissionsunAug 09, 2021
Kids use fruit juice to create ‘positive’ Covid tests in new trend trendtestsliverpoolstudentsschoolcovidfruitkidswarningtrendJun 26, 2021
The 7 tackiest changes Donald Trump has made since returning to office donald trumptrumpwhite houseoval officerose gardenballroomdonald trumpNov 10, 2025
GTA 6 LIVE: Trailer 3 speculation sparks as official update spotted gta 6gamesgrand theft autorockstar gamesvideo gamesgta 614h
Sydney Sweeney speaks out as latest film Christy flops at box office sydney sweeneychristyfilmbox officeboxingsydney sweeney14h
1 million Toyota Lexus and Subaru Solterras recalled - what to know toyotarecallcarstoyotaNov 06, 2025
Zohran Mamdani's marriage is helping people keep faith in dating apps zohran mamdaninew yorkmarriagedating appsrelationshipsrama duwajizohran mamdaniNov 06, 2025
Kim Kardashian's 'All's Fair' declared 'worst TV show ever' all's fairkim kardashiantv seriesdivorceryan murphyall's fairNov 05, 2025
Elon Musk condemned over ‘civil war in Britain’ remarks Elon Musknewscivil warimmigrationtwitterbritainelon muskElon MuskOct 30, 2025
Did Trump forget to say his own name? Donald Trumpnewsnflmarylandmilitarywashington commandersdetroit lionsdonald trumpDonald TrumpNov 10, 2025